Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein PTGES3L (PTG3L)

This Recombinant Human Putative protein PTGES3L (PTG3L) spans the amino acid sequence from region 1-166. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein PTGES3L; Prostaglandin E synthase 3-like; PTGES3L

UniProt

E9PB15

Expression Region

1-166

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYVFMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDDDSDSADDATSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kctd20 Mouse shRNA Lentiviral Particle (Locus ID 66989)
TL515141V 500 µL Each

Kctd20 Mouse shRNA Lentiviral Particle (Locus ID 66989)

Sign In for Pricing
View Details
UbcH2, human recombinant (His-tag)
4848-100 100 µg

UbcH2, human recombinant (His-tag)

Sign In for Pricing
View Details
PIC P022-Dia 100-PE-ROLL/1 Facility & Office Signs & Labels (Adhesive)
824677 250 Roll (250 Panel (s) x 1 Roll)

PIC P022-Dia 100-PE-ROLL/1 Facility & Office Signs & Labels (Adhesive)

Sign In for Pricing
View Details
GNG5 siRNA (Human)
orb1866399-01 15 nmol

GNG5 siRNA (Human)

Sign In for Pricing
View Details
GNG5 siRNA (Human)
orb1866399-02 30 nmol

GNG5 siRNA (Human)

Sign In for Pricing
View Details
BYSL Peptide - middle region (AAP85265)
AAP85265-100UG 100 µg

BYSL Peptide - middle region (AAP85265)

Sign In for Pricing
View Details