Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ret finger protein-like 4A-like protein 1 (RFAL1)

This Recombinant Human Ret finger protein-like 4A-like protein 1 (RFAL1) spans the amino acid sequence from region 1-287. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ret finger protein-like 4A-like protein 1 RFPL4AL1

UniProt

F8VTS6

Expression Region

1-287

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIELSSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHINTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSTASAPVSSEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psmd3-set siRNA/shRNA/RNAi Lentivector (Rat)
38002096 4x 500 ng

Psmd3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rno-miR-336-3p miRNA Agomir
CMS0383-01 5 nmol

Rno-miR-336-3p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-336-3p miRNA Agomir
CMS0383-02 10 nmol

Rno-miR-336-3p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-336-3p miRNA Agomir
CMS0383-03 20 nmol

Rno-miR-336-3p miRNA Agomir

Sign In for Pricing
View Details
Human ACOT8 qPCR Primer Pair
QH07369S 200 Tests

Human ACOT8 qPCR Primer Pair

Sign In for Pricing
View Details
Soil Laccase Kit
OM626024 100 Tests

Soil Laccase Kit

Sign In for Pricing
View Details