Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Keratin-associated protein 4-16 (KR416)

This Recombinant Human Keratin-associated protein 4-16 (KR416) spans the amino acid sequence from region 1-235. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Keratin-associated protein 4-16 KRTAP4-16 KRTAP4-16P KRTAP4P1

UniProt

G5E9R7

Expression Region

1-235

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCSSKMPCSPSASSLCAASPPNCCHPSCCQTTCCRTTSCSHSCSVSSCCRPQCCHSVCCQPTCCRPSCCQTTCCRTTCCHPSCCVSSCCRPQCCHSVCFQPTCCHPSCCISSSCCPSCCESSCCCPCCCLRPVCGRVSCHVTCYHPTCVISTCPHPLCCASPPLPLPFPSPPVPLPFFLSLALPSPPRPSPPLLSPVLIPSPSPSPSLPSLSPPLPSPPLPSPHFPSVNPKSMLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-500 1x 500 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details