Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial

This Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC35A4 upstream open reading frame protein; SLC35A4 microprotein; SLC35A4-MP; SLC35A4

UniProt

L0R6Q1

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MADDKDSLPKLKDLAFLKNQLESLQRRVEDEVNSGVGQDGSLLSSPFLKGFLAGYVVAKLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone (P) Diagnostic Kit
MF-19 20 Tests/Box

Progesterone (P) Diagnostic Kit

Sign In for Pricing
View Details
PDK1 CRISPRa sgRNA lentivector (set of three targets)(Human)
36320121 3x 1.0µg DNA

PDK1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
C-Yes (C-10) HRP
sc-46674 HRP 200 µg/mL

C-Yes (C-10) HRP

Sign In for Pricing
View Details
Csn1s2b Rat shRNA Lentiviral Particle (Locus ID 286759)
TL713338V 500 µL Each

Csn1s2b Rat shRNA Lentiviral Particle (Locus ID 286759)

Sign In for Pricing
View Details
B4GALT6 Rabbit Polyclonal Antibody (Cy5)
orb970935 100 µL

B4GALT6 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
ASF1A Mouse mAb
63091 100 µL

ASF1A Mouse mAb

Sign In for Pricing
View Details