Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ASNSD1 upstream open reading frame protein (ASURF)

This Recombinant Human ASNSD1 upstream open reading frame protein (ASURF) spans the amino acid sequence from region 1-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASNSD1 upstream open reading frame protein; ASNSD1 small/short open reading frame-encoded polypeptide; ASNSD1-SEP; ASDURF

UniProt

L0R819

Expression Region

1-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIFFLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thymic Cancer Organoid Kit
orb3169840-01 100 mL

Human Thymic Cancer Organoid Kit

Sign In for Pricing
View Details
Human Thymic Cancer Organoid Kit
orb3169840-02 500 mL

Human Thymic Cancer Organoid Kit

Sign In for Pricing
View Details
OR14A16 (NM_001001966) Human Tagged Lenti ORF Clone
RC221649L3 10 µg

OR14A16 (NM_001001966) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SC35 (SRSF2) Human shRNA Plasmid Kit (Locus ID 6427)
TR309491 1 Kit

SC35 (SRSF2) Human shRNA Plasmid Kit (Locus ID 6427)

Sign In for Pricing
View Details
Recombinant Thrombopoietin (TPO)
MBS2162609-01 0.01 mg

Recombinant Thrombopoietin (TPO)

Sign In for Pricing
View Details
Recombinant Thrombopoietin (TPO)
MBS2162609-02 0.05 mg

Recombinant Thrombopoietin (TPO)

Sign In for Pricing
View Details