Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1-like protein (MPC1L), partial

This Recombinant Human Mitochondrial pyruvate carrier 1-like protein (MPC1L), partial spans the amino acid sequence from region 75-136. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1-like protein MPC1L

UniProt

P0DKB6

Expression Region

75-136

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Acid Phosphatase 1 (ACP1)
TRV-0035215-01 20 µL

Monoclonal Antibody to Acid Phosphatase 1 (ACP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Acid Phosphatase 1 (ACP1)
TRV-0035215-02 100 µL

Monoclonal Antibody to Acid Phosphatase 1 (ACP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Acid Phosphatase 1 (ACP1)
TRV-0035215-03 200 µL

Monoclonal Antibody to Acid Phosphatase 1 (ACP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Acid Phosphatase 1 (ACP1)
TRV-0035215-04 1 mL

Monoclonal Antibody to Acid Phosphatase 1 (ACP1)

Sign In for Pricing
View Details
ZCCHC17 Adenovirus (Human)
50761051 1.0 mL

ZCCHC17 Adenovirus (Human)

Sign In for Pricing
View Details
PRRX1 Rabbit Polyclonal Antibody (Biotin)
orb2127199 100 µL

PRRX1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details