Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metallothionein 1H-like protein 1 (M1BL1)

This Recombinant Human Metallothionein 1H-like protein 1 (M1BL1) spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein 1H-like protein 1 MT1HL1

UniProt

P0DM35

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDPNCSCAAGGSYACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCIRKGASEKCSCCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DARPP32 (Thr34) Antibody
AF3488-01 100 µL

Phospho-DARPP32 (Thr34) Antibody

Sign In for Pricing
View Details
Phospho-DARPP32 (Thr34) Antibody
AF3488-02 200 µL

Phospho-DARPP32 (Thr34) Antibody

Sign In for Pricing
View Details
LILRA6 CRISPRa sgRNA lentivector (set of three targets)(Human)
26525121 3x 1.0µg DNA

LILRA6 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Phospho-ERBB3 (Tyr1328) Polyclonal Antibody, Cy5 Conjugated
bs-5340R-Cy5-TR 20 µL

Phospho-ERBB3 (Tyr1328) Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
EEF2 (Phospho Thr56/Thr58) (19R14) Rabbit Monoclonal Antibody
E28G2447 100 µL

EEF2 (Phospho Thr56/Thr58) (19R14) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Stat4 (C-4) Alexa Fluor® 680
sc-398228 AF680 200 µg/mL

Stat4 (C-4) Alexa Fluor® 680

Sign In for Pricing
View Details