Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G3 (OR83P), partial

This Recombinant Human Olfactory receptor 8G3 (OR83P), partial spans the amino acid sequence from region 161-197. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 8G3; Olfactory receptor OR11-297; OR8G3 OR8G3P

UniProt

P0DMU2

Expression Region

161-197

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SFMLRLFLCKTNVINHYFCDLFPLLGLSCSSTYINEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxyethyl cellulose, high viscosity
GC2093-250g 250 g

Hydroxyethyl cellulose, high viscosity

Sign In for Pricing
View Details
ACY1 Recombinant Protein
OPCD01075-50UG 50 µg

ACY1 Recombinant Protein

Sign In for Pricing
View Details
CSNK1A1 Antibody
A11811-100UG 100 µg

CSNK1A1 Antibody

Sign In for Pricing
View Details
Col28a1 (NM_001037865) Mouse Tagged ORF Clone Lentiviral Particle
MR220313L4V 200 µL

Col28a1 (NM_001037865) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bovine Orexin A (OXA) ELISA Kit
RDR-OXA-b-48Tests 48 Tests

Bovine Orexin A (OXA) ELISA Kit

Sign In for Pricing
View Details
MRPL40 Protein Vector (Human) (pPM-C-HA)
30484021 500 ng

MRPL40 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details