Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda-1 light chain (IGL1)

This Recombinant Human Immunoglobulin lambda-1 light chain (IGL1) spans the amino acid sequence from region 1-216. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda-1 light chain; Immunoglobulin lambda-1 light chain MCG

UniProt

P0DOX8

Expression Region

1-216

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-18 Protein (C-Halo, Mouse)
P516035 100 µg

IL-18 Protein (C-Halo, Mouse)

Sign In for Pricing
View Details
3,5-Dimethylisatoic anhydride
427486-01 100 mg

3,5-Dimethylisatoic anhydride

Sign In for Pricing
View Details
3,5-Dimethylisatoic anhydride
427486-02 250 mg

3,5-Dimethylisatoic anhydride

Sign In for Pricing
View Details
UNC93B5 3'UTR GFP Stable Cell Line
TU077846 1.0 mL

UNC93B5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Necab3 3'UTR Luciferase Stable Cell Line
TU113968 1.0 mL

Necab3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DP 432
orb1986098-01 100 mg

DP 432

Sign In for Pricing
View Details