Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gelsolin / Actin-depolymerizing Factor (CPTC-Gelsolin-1), CF594 conjugate, 0.1mg/mL
BNC942239-100 1x 100 µL

Gelsolin / Actin-depolymerizing Factor (CPTC-Gelsolin-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS633993 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS509706 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), CF740 conjugate, 0.1mg/mL
BNC743241-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF568 conjugate, 0.1mg/mL
BNC682155-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF405S conjugate, 0.1mg/mL
BNC042295-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details