Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC14 (NM_032364) Human Recombinant Protein
TP322220M 100 µg

DNAJC14 (NM_032364) Human Recombinant Protein

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (rAURKB/1592), 0.2mg/mL
BNUB3787-500 1x 500 µL

Aurora B (Proliferation Marker) (rAURKB/1592), 0.2mg/mL

Sign In for Pricing
View Details
Human SLC25A38 activation kit by CRISPRa
GA110421 1 Kit

Human SLC25A38 activation kit by CRISPRa

Sign In for Pricing
View Details
Pyrrole-2,3-dicarboxylic Acid Monohydrate
TRC-P997880-5MG 5 mg

Pyrrole-2,3-dicarboxylic Acid Monohydrate

Sign In for Pricing
View Details
Syt11 Mouse Gene Knockout Kit (CRISPR)
KN517078 1 Kit

Syt11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant PTP1B Antibody
RC-15513-01 50 μL

Recombinant PTP1B Antibody

Sign In for Pricing
View Details