Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: bilateral
CS701102 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details
Malonic Acid-1,2,3-13C3
TRC-M158009-10MG 10 mg

Malonic Acid-1,2,3-13C3

Sign In for Pricing
View Details
KHSRP Mouse Monoclonal Antibody [A7-B0]
EM1701-97 100 µL

KHSRP Mouse Monoclonal Antibody [A7-B0]

Sign In for Pricing
View Details
ROBO1 Human Gene Knockout Kit (CRISPR)
KN211961RB 1 Kit

ROBO1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
10-Bromo-1-decanol
TRC-B688690-5G 5 g

10-Bromo-1-decanol

Sign In for Pricing
View Details
CD45 / LCA (CD45RB) Rat Monoclonal Antibody [Clone ID: 16A]
CL029RX 300 µg

CD45 / LCA (CD45RB) Rat Monoclonal Antibody [Clone ID: 16A]

Sign In for Pricing
View Details