Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine TR (Thrombin Receptor) ValidElisa Kit
EK345516 96 Well

Porcine TR (Thrombin Receptor) ValidElisa Kit

Sign In for Pricing
View Details
Dxd 5mg
A21517-5 5 mg

Dxd 5mg

Sign In for Pricing
View Details
SUOX Human
32-6918-5 5 µg

SUOX Human

Sign In for Pricing
View Details
IL22RA2 Antibody
MBS9412704-01 0.1 mL

IL22RA2 Antibody

Sign In for Pricing
View Details
IL22RA2 Antibody
MBS9412704-02 5x 0.1 mL

IL22RA2 Antibody

Sign In for Pricing
View Details
Golgi Complex (371-4), CF405S conjugate, 0.1mg/mL
BNC040102-500 1x 500 µL

Golgi Complex (371-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details