Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiLink™ Rapid iFluor® 555 Antibody Labeling Kit *Production Scale*
5705-AAT 3x 1 mg

ReadiLink™ Rapid iFluor® 555 Antibody Labeling Kit *Production Scale*

Sign In for Pricing
View Details
TOR2A antibody
FNab08873 100 µg

TOR2A antibody

Sign In for Pricing
View Details
Iduronate 2 suLfatase (IDS) (NM_001166550) Human Over-expression Lysate
LY433123 100 µg

Iduronate 2 suLfatase (IDS) (NM_001166550) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ABHD13 activation kit by CRISPRa
GA113789 1 Kit

Human ABHD13 activation kit by CRISPRa

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (ID8), CF568 conjugate, 0.1mg/mL
BNC680920-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (ID8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse FETUB (Fetuin B) ELISA Kit
E-EL-M3109-01 24 Tests

Mouse FETUB (Fetuin B) ELISA Kit

Sign In for Pricing
View Details