Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CISH Rabbit Polyclonal Antibody
TA365367 100 µL

CISH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rdh10 Mouse Gene Knockout Kit (CRISPR)
KN514624 1 Kit

Rdh10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAPKAPK2 (Ab-334) Antibody
8B0018-AAT 50 µg

MAPKAPK2 (Ab-334) Antibody

Sign In for Pricing
View Details
St3gal6 Mouse Gene Knockout Kit (CRISPR)
KN516801 1 Kit

St3gal6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-500 1x 500 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant TAK1 (phospho S439) Antibody
RC-6404-01 50 μL

Recombinant TAK1 (phospho S439) Antibody

Sign In for Pricing
View Details