Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T Plastin (PLS3) (NM_001172335) Human Recombinant Protein
PROTP13797 20 µg

T Plastin (PLS3) (NM_001172335) Human Recombinant Protein

Sign In for Pricing
View Details
HIF-1 alpha Antibody, Clone ESEE122: PerCP
SMC-184D-PCP 100 µg

HIF-1 alpha Antibody, Clone ESEE122: PerCP

Sign In for Pricing
View Details
Rat Interleukin 12, IL-12/P40 ELISA Kit
MBS702472-01 24 Well (LIMIT 1)

Rat Interleukin 12, IL-12/P40 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 12, IL-12/P40 ELISA Kit
MBS702472-02 48 Well

Rat Interleukin 12, IL-12/P40 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 12, IL-12/P40 ELISA Kit
MBS702472-03 96 Well

Rat Interleukin 12, IL-12/P40 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 12, IL-12/P40 ELISA Kit
MBS702472-04 5x 96 Well

Rat Interleukin 12, IL-12/P40 ELISA Kit

Sign In for Pricing
View Details