Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34)

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-STAT3 Antibody Picoband® (Dylight594 Conjugate)
PB9511-Dylight594 100 µg

Anti-STAT3 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
IFNB1 ELISA Kit (Rat) (OKAN04645)
OKAN04645 96 Well

IFNB1 ELISA Kit (Rat) (OKAN04645)

Sign In for Pricing
View Details
Collagen Type I (FITC)
MBS6243231-01 0.1 mL

Collagen Type I (FITC)

Sign In for Pricing
View Details
Collagen Type I (FITC)
MBS6243231-02 5x 0.1 mL

Collagen Type I (FITC)

Sign In for Pricing
View Details
SREBP2 Polyclonal Antibody, PerCP Conjugated
bs-2536R-PerCP 100 µL

SREBP2 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
MIRacle™ hsa-miR-6850-5p miRNA Agomir/Antagomir
AM1986 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-6850-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details