Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34)

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp790 Protein Vector (Mouse) (pPB-C-His)
PV250266 500 ng

Zfp790 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Htra1 (NM_019564) Mouse Tagged ORF Clone
MR207695 10 µg

Htra1 (NM_019564) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Putative uncharacterized protein C3orf47 (C3orf47) Human ELISA Kit
G5712 96 Tests

Putative uncharacterized protein C3orf47 (C3orf47) Human ELISA Kit

Sign In for Pricing
View Details
Tif11 Antibody
orb854674 2 mg

Tif11 Antibody

Sign In for Pricing
View Details
Fmoc-N-Me-Thr(tBu)-OH
5-05486 5 g

Fmoc-N-Me-Thr(tBu)-OH

Sign In for Pricing
View Details
OR51J1 3'UTR Luciferase Stable Cell Line
TU017078 1.0 mL

OR51J1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details