Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34)

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleoplasmin-2 NPM2 Rabbit Polyclonal Antibody (PE)
orb2575951 100 µg

Nucleoplasmin-2 NPM2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
STIM1 Immunizing Peptide
orb17195 100 µg

STIM1 Immunizing Peptide

Sign In for Pricing
View Details
Human TLR2/Toll-like receptor 2 ELISA Kit
orb76063 96 Tests

Human TLR2/Toll-like receptor 2 ELISA Kit

Sign In for Pricing
View Details
Olfr191 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4183904 1.0 µg DNA

Olfr191 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Zfp219 3'UTR Luciferase Stable Cell Line
TU122625 1.0 mL

Zfp219 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TCF21 3'UTR Lenti-reporter-Luc Vector
46379081 1.0 µg

TCF21 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details