Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431)

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZIKA VIRUS antibody Elisa Kit
QY-E05416 96 Tests

Human ZIKA VIRUS antibody Elisa Kit

Sign In for Pricing
View Details
Plakophilin 1 Rabbit Polyclonal Antibody (BF680)
orb2392804 100 µL

Plakophilin 1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
MIRacle™ hsa-miR-299-3p miRNA Agomir/Antagomir
AM2017 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-299-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Nephrin Rabbit Polyclonal Antibody (PE)
orb493968 100 µL

Nephrin Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
H-Cys-OH · HCl · H₂O
4030461.01 100 g

H-Cys-OH · HCl · H₂O

Sign In for Pricing
View Details
Cyclin D2 Polyclonal Antibody
JOT-AP02351-01 20 µL

Cyclin D2 Polyclonal Antibody

Sign In for Pricing
View Details