Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82)

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chloramphenicol 1-Acetate
TRC-C325090-25MG 25 mg

Chloramphenicol 1-Acetate

Sign In for Pricing
View Details
4-Bromoisophthalic Acid
TRC-B686208-5G 5 g

4-Bromoisophthalic Acid

Sign In for Pricing
View Details
Human HKDC1 activation kit by CRISPRa
GA112863 1 Kit

Human HKDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
CPEB1 (NM_001079533) Human Over-expression Lysate
LC421521 20 µg

CPEB1 (NM_001079533) Human Over-expression Lysate

Sign In for Pricing
View Details
Retinol Binding Protein-1 (G4E4), 1mg/mL
BNUM0855-50 1x 50 µL

Retinol Binding Protein-1 (G4E4), 1mg/mL

Sign In for Pricing
View Details
(R)- Niraparib Tosylate
TRC-N481410-25MG 25 mg

(R)- Niraparib Tosylate

Sign In for Pricing
View Details