Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82)

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CellQuanti-Blue™ Cell Viability Assay Kits
CQBL-05K 5000 Tests

CellQuanti-Blue™ Cell Viability Assay Kits

Sign In for Pricing
View Details
10-Hydroxydecylphosphate Diammonium Salt
TRC-H573880-250MG 250 mg

10-Hydroxydecylphosphate Diammonium Salt

Sign In for Pricing
View Details
Human LRFN4 activation kit by CRISPRa
GA112299 1 Kit

Human LRFN4 activation kit by CRISPRa

Sign In for Pricing
View Details
(S,S)-(-)-Hydrobenzoin
TRC-H714520-5G 5 g

(S,S)-(-)-Hydrobenzoin

Sign In for Pricing
View Details
1,3-O-Bis(triisopropylsilyl) 2-Oleoyl Glycerol-d5
TRC-B588662-5MG 5 mg

1,3-O-Bis(triisopropylsilyl) 2-Oleoyl Glycerol-d5

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3287), CF568 conjugate, 0.1mg/mL
BNC683287-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3287), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details