Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113)

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosine hydroxylase Antibody, mAb, Rabbit
A02937-50 50 µL

Tyrosine hydroxylase Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Human FH Protein, His Tag
KMPH3485-01 50 µg

Human FH Protein, His Tag

Sign In for Pricing
View Details
Human FH Protein, His Tag
KMPH3485-02 100 µg

Human FH Protein, His Tag

Sign In for Pricing
View Details
6-Bromo-5-methyl[1,2,4]triazolo[1,5-a]pyridine
438129-01 25 mg

6-Bromo-5-methyl[1,2,4]triazolo[1,5-a]pyridine

Sign In for Pricing
View Details
6-Bromo-5-methyl[1,2,4]triazolo[1,5-a]pyridine
438129-02 50 mg

6-Bromo-5-methyl[1,2,4]triazolo[1,5-a]pyridine

Sign In for Pricing
View Details
HEPACAM Human Pre-designed siRNA Set A
HY-RS06122 1 Set

HEPACAM Human Pre-designed siRNA Set A

Sign In for Pricing
View Details