Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113)

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf81 (ELP5) (NM_203413) Human Over-expression Lysate
E45H16590-2 20 µg

C17orf81 (ELP5) (NM_203413) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Frizzled-4/FZD4 Protein (Fc Tag)
PKSH030493 50 µg

Recombinant Human Frizzled-4/FZD4 Protein (Fc Tag)

Sign In for Pricing
View Details
NR2C1 Human Over-expression Lysate
orb1363502 20 µg

NR2C1 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Nfia Pre-designed siRNA Set B
SI109302B 1 Each

Mouse Nfia Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human CD58 ELISA Kit
ELA-E0903h 96 Tests

Human CD58 ELISA Kit

Sign In for Pricing
View Details
NEK9, CT (NIMA (Never in Mitosis Gene A) -Related Kinase 9, Never in Mitosis A-related Kinase 9, NIMA-related Kinase Nek9, NimA-related Protein Kinase 9, DKFZp434D0935, HGNC:18591, KIAA1995, MGC138306, MGC16714, Nercc1 Kinase, NERCC1, NERCC, NIMA-related Kinase Nek8, Nek8, Serine/threonine Protein Kinase Nek9) (APC) discontinued
N0800-09E-APC 200 µL

NEK9, CT (NIMA (Never in Mitosis Gene A) -Related Kinase 9, Never in Mitosis A-related Kinase 9, NIMA-related Kinase Nek9, NimA-related Protein Kinase 9, DKFZp434D0935, HGNC:18591, KIAA1995, MGC138306, MGC16714, Nercc1 Kinase, NERCC1, NERCC, NIMA-related Kinase Nek8, Nek8, Serine/threonine Protein Kinase Nek9) (APC) discontinued

Sign In for Pricing
View Details