Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113)

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT9 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV671130 1.0 µg DNA

FUT9 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Purified Mouse IgG1 k isotype Control
FC1268 1 mg

Purified Mouse IgG1 k isotype Control

Sign In for Pricing
View Details
CDK12-Cyclin K Ligand-Linker Conjugates 1
HY-176791 1 Each

CDK12-Cyclin K Ligand-Linker Conjugates 1

Sign In for Pricing
View Details
Human KSR2 Pre-designed siRNA Set B
SI008498B 1 Each

Human KSR2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal VAMP-8 Antibody [Allophycocyanin]
NBP2-32095APC 0.1 mL

Rabbit Polyclonal VAMP-8 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
CUP1-1 Antibody
A77942-50UL 50 μL

CUP1-1 Antibody

Sign In for Pricing
View Details