Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B)

This Recombinant Human Beta-defensin 130B (D130B) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (L1C1), CF640R conjugate, 0.1mg/mL
BNC400018-100 1x 100 µL

Human Kappa Light Chain (L1C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pentafluorothiophenol
TRC-P273565-50MG 50 mg

Pentafluorothiophenol

Sign In for Pricing
View Details
SREBP1 (SREBP1/1578), CF488A conjugate, 0.1mg/mL
BNC881578-100 1x 100 µL

SREBP1 (SREBP1/1578), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulin (GRN) Mouse Monoclonal Antibody [Clone ID: OTI4B9]
CF807349 100 µg

Granulin (GRN) Mouse Monoclonal Antibody [Clone ID: OTI4B9]

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS632833 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
KIAA0323 (KHNYN) (NM_001290257) Human Tagged ORF Clone
RG239294 10 µg

KIAA0323 (KHNYN) (NM_001290257) Human Tagged ORF Clone

Sign In for Pricing
View Details