Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B)

This Recombinant Human Beta-defensin 130B (D130B) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3beta-Dihydroxy-19-norandrost-5(10)-ene
TRC-D499330-250MG 250 mg

3beta-Dihydroxy-19-norandrost-5(10)-ene

Sign In for Pricing
View Details
2-(4-Morpholinyl)ethyl 1-Phenylcyclohexane Carboxylate Hydrochloride
TRC-M725060-10MG 10 mg

2-(4-Morpholinyl)ethyl 1-Phenylcyclohexane Carboxylate Hydrochloride

Sign In for Pricing
View Details
Bis(tert-butylamino)chloro-s-triazine
TRC-B415145-100MG 100 mg

Bis(tert-butylamino)chloro-s-triazine

Sign In for Pricing
View Details
Anti-PEPC | phosphoenolpyruvate carboxylase, DyLight® 650 conjugated (40 µg)
AS09 458-DL650 40 µg

Anti-PEPC | phosphoenolpyruvate carboxylase, DyLight® 650 conjugated (40 µg)

Sign In for Pricing
View Details
WDR31 Human Gene Knockout Kit (CRISPR)
KN417345 1 Kit

WDR31 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HS6ST2 Antibody
KC-43153-01 50 μL

HS6ST2 Antibody

Sign In for Pricing
View Details