Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B)

This Recombinant Human Beta-defensin 130B (D130B) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RCSD 1 (RCSD1) activation kit by CRISPRa
GA114193 1 Kit

Human RCSD 1 (RCSD1) activation kit by CRISPRa

Sign In for Pricing
View Details
Leurosine Sulfate
TRC-L330800-5MG 5 mg

Leurosine Sulfate

Sign In for Pricing
View Details
Anti Human PACSIN3 Polyclonal
Y054742 100 µL

Anti Human PACSIN3 Polyclonal

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS502908 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
N,N’-Bisboc N,N'-L-Cystinyldiglycine-13C4,15N2 Dibenzyl Ester
TRC-B414117-5MG 5 mg

N,N’-Bisboc N,N'-L-Cystinyldiglycine-13C4,15N2 Dibenzyl Ester

Sign In for Pricing
View Details
Pyrroloquinoline Quineone Impurity
TRC-P449610-25MG 25 mg

Pyrroloquinoline Quineone Impurity

Sign In for Pricing
View Details