Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial

This Recombinant Human V-set and immunoglobulin domain-containing protein 8 (VSIG8), partial spans the amino acid sequence from region 22-263. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

V-set and immunoglobulin domain-containing protein 8 VSIG8 C1orf204

UniProt

P0DPA2

Expression Region

22-263

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPNT1 (NM_001286150) Human Tagged ORF Clone
RG237076 10 µg

BPNT1 (NM_001286150) Human Tagged ORF Clone

Sign In for Pricing
View Details
GUCY1B1 (C-term) Rabbit Polyclonal Antibody
AP15185PU-N 400 µL

GUCY1B1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant AKT1 (phospho S129) Antibody
RC-16368-01 50 μL

Recombinant AKT1 (phospho S129) Antibody

Sign In for Pricing
View Details
Recombinant AKT1 (phospho S129) Antibody
RC-16368-02 100 µL

Recombinant AKT1 (phospho S129) Antibody

Sign In for Pricing
View Details
Recombinant AKT1 (phospho S129) Antibody
RC-16368-03 1 mL

Recombinant AKT1 (phospho S129) Antibody

Sign In for Pricing
View Details
τ-Fluvalinate (Mixture of 2 Diastereomers)
TRC-F601100-25MG 25 mg

τ-Fluvalinate (Mixture of 2 Diastereomers)

Sign In for Pricing
View Details