Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22)

This Recombinant Human Protein POLR1D, isoform 2 (RPC22) spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMBRA1 Polyclonal Antibody
E912578 100 µL

AMBRA1 Polyclonal Antibody

Sign In for Pricing
View Details
S15A2 rabbit pAb
E44H14021 100 µL

S15A2 rabbit pAb

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0042 nucleotide-binding protein yhbJ (yhbJ)
MBS1172850-01 0.02 mg (E-Coli)

Recombinant Salmonella enteritidis PT4 UPF0042 nucleotide-binding protein yhbJ (yhbJ)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0042 nucleotide-binding protein yhbJ (yhbJ)
MBS1172850-02 0.02 mg (Yeast)

Recombinant Salmonella enteritidis PT4 UPF0042 nucleotide-binding protein yhbJ (yhbJ)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0042 nucleotide-binding protein yhbJ (yhbJ)
MBS1172850-03 0.1 mg (E-Coli)

Recombinant Salmonella enteritidis PT4 UPF0042 nucleotide-binding protein yhbJ (yhbJ)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0042 nucleotide-binding protein yhbJ (yhbJ)
MBS1172850-04 0.1 mg (Yeast)

Recombinant Salmonella enteritidis PT4 UPF0042 nucleotide-binding protein yhbJ (yhbJ)

Sign In for Pricing
View Details