Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35)

This Recombinant Human T cell receptor alpha variable 35 (TVA35) spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRDV1/TCR VD 1 Mouse Monoclonal Antibody
orb2975414-01 50 µg

TRDV1/TCR VD 1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TRDV1/TCR VD 1 Mouse Monoclonal Antibody
orb2975414-02 100 µg

TRDV1/TCR VD 1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rhox4c Double Nickase Plasmid (m)
sc-436690-NIC 20 µg

Rhox4c Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Cd70 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6357704 1.0 µg DNA

Cd70 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Prl shRNA (UAS) - Lentiviral mousePrl shRNA (UAS, GFP) (25)
GTR15187652 1 Vial

Lentiviral mouse Prl shRNA (UAS) - Lentiviral mousePrl shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Plscr3 Mouse qPCR Primer Pair (NM_023564)
MP210977 200 Reactions

Plscr3 Mouse qPCR Primer Pair (NM_023564)

Sign In for Pricing
View Details