Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35)

This Recombinant Human T cell receptor alpha variable 35 (TVA35) spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A25 siRNA (Human)
orb1850518-01 15 nmol

SLC22A25 siRNA (Human)

Sign In for Pricing
View Details
SLC22A25 siRNA (Human)
orb1850518-02 30 nmol

SLC22A25 siRNA (Human)

Sign In for Pricing
View Details
1- (4-Bromo-2-fluorophenyl) propan-2-one
YZB27882-01 100 mg

1- (4-Bromo-2-fluorophenyl) propan-2-one

Sign In for Pricing
View Details
1- (4-Bromo-2-fluorophenyl) propan-2-one
YZB27882-02 1 g

1- (4-Bromo-2-fluorophenyl) propan-2-one

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-9 Antibody (MM0552-6K12) [DyLight 550]
NBP2-11905R 0.1 mL

Mouse Monoclonal Siglec-9 Antibody (MM0552-6K12) [DyLight 550]

Sign In for Pricing
View Details
Rabbit Polyclonal Sarcalumenin Antibody [Allophycocyanin]
NBP2-97668APC 0.1 mL

Rabbit Polyclonal Sarcalumenin Antibody [Allophycocyanin]

Sign In for Pricing
View Details