Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35)

This Recombinant Human T cell receptor alpha variable 35 (TVA35) spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sucrose octasulfate-aluminum complex
GC0234-5g 5 g

Sucrose octasulfate-aluminum complex

Sign In for Pricing
View Details
C4orf32 (43-68) (Human)
041-89 100 µg

C4orf32 (43-68) (Human)

Sign In for Pricing
View Details
GATA-2 (CG2-96) Alexa Fluor® 594
sc-267 AF594 200 µg/mL

GATA-2 (CG2-96) Alexa Fluor® 594

Sign In for Pricing
View Details
Phospho-Stat2 (Tyr690) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-3428R-BF594-TR 20 µL

Phospho-Stat2 (Tyr690) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ACSS1 Polyclonal Conjugated Antibody
C28801 100 µL

ACSS1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TREML1 Rabbit pAb, PE-Cy7 conjugated
orb2845754 100 µL

TREML1 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details