Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63)

This Recombinant Human T cell receptor beta variable 6-3 (TVB63) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C19orf44 activation kit by CRISPRa
GA113403 1 Kit

Human C19orf44 activation kit by CRISPRa

Sign In for Pricing
View Details
MMP-14 Recombinant Rabbit monoclonal Antibody [SJ18-09]
ET1606-48-50UL 50 µL

MMP-14 Recombinant Rabbit monoclonal Antibody [SJ18-09]

Sign In for Pricing
View Details
Cy3B NHS ester
949-AAT 5 mg

Cy3B NHS ester

Sign In for Pricing
View Details
RPS6KC1 (NM_012424) Human Over-expression Lysate
LC402211 20 µg

RPS6KC1 (NM_012424) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Propionylglycine-13C2,15N
TRC-N459633-2.5MG 2.5 mg

N-Propionylglycine-13C2,15N

Sign In for Pricing
View Details
RealStar®EBV PCR Kit 2.0
132013 96 Tests

RealStar®EBV PCR Kit 2.0

Sign In for Pricing
View Details