Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63)

This Recombinant Human T cell receptor beta variable 6-3 (TVB63) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin-19 Antibody
KC-667-01 50 μL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-667-02 100 µL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-667-03 1 mL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
IL4I1 antibody
FNab09965 100 µg

IL4I1 antibody

Sign In for Pricing
View Details
Kv beta 1 (KCNAB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G3]
TA503910AM 100 µL

Kv beta 1 (KCNAB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G3]

Sign In for Pricing
View Details
Vmn2r105 Mouse Gene Knockout Kit (CRISPR)
KN519119 1 Kit

Vmn2r105 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details