Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63)

This Recombinant Human T cell receptor beta variable 6-3 (TVB63) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kinesin Family, Member 5B (KIF5B) ELISA Kit
RDR-KIF5B-Mu-01 96 Tests

Mouse Kinesin Family, Member 5B (KIF5B) ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin Family, Member 5B (KIF5B) ELISA Kit
RDR-KIF5B-Mu-02 48 Tests

Mouse Kinesin Family, Member 5B (KIF5B) ELISA Kit

Sign In for Pricing
View Details
Human Tubulin Beta 3 (TUBb3) ELISA Kit
RDR-TUBb3-Hu-01 96 Tests

Human Tubulin Beta 3 (TUBb3) ELISA Kit

Sign In for Pricing
View Details
Human Tubulin Beta 3 (TUBb3) ELISA Kit
RDR-TUBb3-Hu-02 48 Tests

Human Tubulin Beta 3 (TUBb3) ELISA Kit

Sign In for Pricing
View Details
Mouse F2rl3 activation kit by CRISPRa
GA201338 1 Kit

Mouse F2rl3 activation kit by CRISPRa

Sign In for Pricing
View Details
Cardiac Troponin I Antibody
KC-6318-01 50 μL

Cardiac Troponin I Antibody

Sign In for Pricing
View Details