Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM166B (NM_001099951) Human Over-expression Lysate
LY420215 100 µg

FAM166B (NM_001099951) Human Over-expression Lysate

Sign In for Pricing
View Details
Liprin alpha 1 (PPFIA1) Rabbit Polyclonal Antibody
TA371070 100 µL

Liprin alpha 1 (PPFIA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bulk Anti-Human CD11a (38) Antibody
ICH1006-25mg 25 mg

Bulk Anti-Human CD11a (38) Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS638112 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Recombinant Human PCSK9 Protein (AVI Tag)
PKSH032946-01 20 µg

Recombinant Human PCSK9 Protein (AVI Tag)

Sign In for Pricing
View Details
Recombinant Human PCSK9 Protein (AVI Tag)
PKSH032946-02 100 µg

Recombinant Human PCSK9 Protein (AVI Tag)

Sign In for Pricing
View Details