Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF568 conjugate, 0.1mg/mL
BNC682993-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mitochondrial Marker Antibody Sampler Kit
HAK21041 1 Kit

Mitochondrial Marker Antibody Sampler Kit

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI3D2]
CF813248 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI3D2]

Sign In for Pricing
View Details
Recombinant T Box Brain Protein 1 Antibody
RC-15525-01 50 μL

Recombinant T Box Brain Protein 1 Antibody

Sign In for Pricing
View Details
Recombinant T Box Brain Protein 1 Antibody
RC-15525-02 100 µL

Recombinant T Box Brain Protein 1 Antibody

Sign In for Pricing
View Details
Recombinant T Box Brain Protein 1 Antibody
RC-15525-03 1 mL

Recombinant T Box Brain Protein 1 Antibody

Sign In for Pricing
View Details