Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNIP1 Antibody: ATTO 390
SPC-718D-A390 100 µg

FNIP1 Antibody: ATTO 390

Sign In for Pricing
View Details
Calnexin (CANX) Rabbit Polyclonal Antibody
TA374243 100 µL

Calnexin (CANX) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Digital Display Ultrasonic Cleaner BULC-302
BULC-302 1 Unit

Digital Display Ultrasonic Cleaner BULC-302

Sign In for Pricing
View Details
Tissue Protein Lysate, Breast
CP531533 150 µg

Tissue Protein Lysate, Breast

Sign In for Pricing
View Details
Human IL-22, C-His, Flag Tag
HA210691-01 20 µg

Human IL-22, C-His, Flag Tag

Sign In for Pricing
View Details
Human IL-22, C-His, Flag Tag
HA210691-02 50 µg

Human IL-22, C-His, Flag Tag

Sign In for Pricing
View Details