Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)
FY-AB48135-01 1 mL

Anti-Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)

Sign In for Pricing
View Details
Anti-Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)
FY-AB48135-02 100 µL

Anti-Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)

Sign In for Pricing
View Details
Anti-Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)
FY-AB48135-03 200 µL

Anti-Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1)

Sign In for Pricing
View Details
Pig E-selectin (E-selectin) ELISA Kit
orb2811571-01 48 Tests

Pig E-selectin (E-selectin) ELISA Kit

Sign In for Pricing
View Details
Pig E-selectin (E-selectin) ELISA Kit
orb2811571-02 96 Tests

Pig E-selectin (E-selectin) ELISA Kit

Sign In for Pricing
View Details
Pig E-selectin (E-selectin) ELISA Kit
orb2811571-03 5 x 96 T

Pig E-selectin (E-selectin) ELISA Kit

Sign In for Pricing
View Details