Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein HRURF (HRURF)

This Recombinant Human Protein HRURF (HRURF) spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein HRURF; HR upstream open reading frame protein; HRURF U2HR

UniProt

P0DUH7

Expression Region

1-34

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQPTASAQKLVRPIRAVCRILQIPESDPSNLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TTC26 activation kit by CRISPRa
GA112774 1 Kit

Human TTC26 activation kit by CRISPRa

Sign In for Pricing
View Details
DOCK5 Human Gene Knockout Kit (CRISPR)
KN424052 1 Kit

DOCK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Factor Related Apoptosis (FAS) ELISA Kit
RD-FAS-Mu-01 96 Tests

Mouse Factor Related Apoptosis (FAS) ELISA Kit

Sign In for Pricing
View Details
Mouse Factor Related Apoptosis (FAS) ELISA Kit
RD-FAS-Mu-02 48 Tests

Mouse Factor Related Apoptosis (FAS) ELISA Kit

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF405S conjugate, 0.1mg/mL
BNC041671-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human PDCD1/PD-1/CD279 (C-6His-Avi) Biotinylated
PKSH033853-01 20 µg

Recombinant Human PDCD1/PD-1/CD279 (C-6His-Avi) Biotinylated

Sign In for Pricing
View Details