Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-D, Human (HEK293, His)

VEGF-D protein is a potent growth factor in angiogenesis, lymphangiogenesis, and endothelial cell growth, playing a key role in stimulating cell proliferation, migration, and affecting vascular permeability. It may be involved in the formation of veins and lymphatic vasculature during embryogenesis, suggesting that it plays a key role in vascular development. VEGF-D Protein, Human (HEK293, His) is the recombinant human-derived VEGF-D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-d-protein-human-hek-293-his.html

Purity

98.0

Smiles

FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS

Molecular Formula

2277 (Gene_ID) O43915 (F93-S201) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGPRX1 Protein Vector (Human) (pPB-N-His)
PV100831 500 ng

MRGPRX1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
OR2K2 HDR Plasmid (h)
sc-418017-HDR 20 µg

OR2K2 HDR Plasmid (h)

Sign In for Pricing
View Details
Sin3b sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3728104 1.0 µg DNA

Sin3b sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Tmem30a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
47037116 3x 1.0 µg

Tmem30a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae UPF0041 protein YHR162W (YHR162W)
MBS7040008-01 0.02 mg

Recombinant Saccharomyces cerevisiae UPF0041 protein YHR162W (YHR162W)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae UPF0041 protein YHR162W (YHR162W)
MBS7040008-02 0.1 mg

Recombinant Saccharomyces cerevisiae UPF0041 protein YHR162W (YHR162W)

Sign In for Pricing
View Details