Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-D, Human (HEK293, His)

VEGF-D protein is a potent growth factor in angiogenesis, lymphangiogenesis, and endothelial cell growth, playing a key role in stimulating cell proliferation, migration, and affecting vascular permeability. It may be involved in the formation of veins and lymphatic vasculature during embryogenesis, suggesting that it plays a key role in vascular development. VEGF-D Protein, Human (HEK293, His) is the recombinant human-derived VEGF-D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-d-protein-human-hek-293-his.html

Purity

98.0

Smiles

FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS

Molecular Formula

2277 (Gene_ID) O43915 (F93-S201) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dgka (NM_016811) Mouse Tagged ORF Clone Lentiviral Particle
MR210336L4V 200 µL

Dgka (NM_016811) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ATP10B Protein Vector (Human) (pPB-C-His)
PV063669 500 ng

ATP10B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
TACR3 CRISPRa sgRNA lentivector (set of three targets)(Human)
46058121 3x 1.0µg DNA

TACR3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
KRAS, CT (KRAS, KRAS2, RASK2, GTPase KRas, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras, GTPase KRas, N-terminally processed) (Biotin)
MBS6314449-01 0.2 mL

KRAS, CT (KRAS, KRAS2, RASK2, GTPase KRas, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras, GTPase KRas, N-terminally processed) (Biotin)

Sign In for Pricing
View Details
KRAS, CT (KRAS, KRAS2, RASK2, GTPase KRas, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras, GTPase KRas, N-terminally processed) (Biotin)
MBS6314449-02 5x 0.2 mL

KRAS, CT (KRAS, KRAS2, RASK2, GTPase KRas, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras, GTPase KRas, N-terminally processed) (Biotin)

Sign In for Pricing
View Details
Necab1 Rat siRNA Oligo Duplex (Locus ID 64169)
SR507951 1 Kit

Necab1 Rat siRNA Oligo Duplex (Locus ID 64169)

Sign In for Pricing
View Details