Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP)

This Recombinant Human Splicing regulatory small protein (SRSP) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM21 Recombinant Rabbit Monoclonal Antibody [PSH02-56]
HA721832 100 µL

TRIM21 Recombinant Rabbit Monoclonal Antibody [PSH02-56]

Sign In for Pricing
View Details
Sodium (Na+) Colorimetric Assay Kit
E-BC-K207-S-01 50 Assays (46 samples)

Sodium (Na+) Colorimetric Assay Kit

Sign In for Pricing
View Details
Sodium (Na+) Colorimetric Assay Kit
E-BC-K207-S-02 100 Assays (96 samples)

Sodium (Na+) Colorimetric Assay Kit

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r2H11), CF488A conjugate, 0.1mg/mL
BNC882161-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (r2H11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C.I.Acid black 94 (Technical Grade)
TRC-C216860-50MG 50 mg

C.I.Acid black 94 (Technical Grade)

Sign In for Pricing
View Details
GRID2IP (NM_001145118) Human Over-expression Lysate
LC428702 20 µg

GRID2IP (NM_001145118) Human Over-expression Lysate

Sign In for Pricing
View Details