Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP)

This Recombinant Human Splicing regulatory small protein (SRSP) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 610 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102UT-01 25 µg

Elab Fluor® Violet 610 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102UT-02 100 µg

Elab Fluor® Violet 610 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Exosc1 (NM_025644) Mouse Tagged ORF Clone
MG201902 10 µg

Exosc1 (NM_025644) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
N-(5-amino-4-(3-(3-cyclohexylureido)-1-(pyrazine-2-carbonyl)pyrrolidine-2-carboxamido)-5-oxopentyl)pyrazine-2-carboxamide
TRC-C558300-10MG 10 mg

N-(5-amino-4-(3-(3-cyclohexylureido)-1-(pyrazine-2-carbonyl)pyrrolidine-2-carboxamido)-5-oxopentyl)pyrazine-2-carboxamide

Sign In for Pricing
View Details
FITC Conjugated Griffonia simplicifolia Lectin -GS-I-A4 -
F-2401-A-1 1 mg

FITC Conjugated Griffonia simplicifolia Lectin -GS-I-A4 -

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS628314 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details