Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP)

This Recombinant Human Splicing regulatory small protein (SRSP) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATR Rabbit Polyclonal Antibody
AP08085PU-S 50 µL

ATR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vimentin (VIM) Rabbit Polyclonal Antibody
TA383240 100 µL

Vimentin (VIM) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM229A (NM_001167676) Human Recombinant Protein
TP329555L 1 mg

FAM229A (NM_001167676) Human Recombinant Protein

Sign In for Pricing
View Details
53BP1 (TP53BP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12D4]
TA807151AM 100 µL

53BP1 (TP53BP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12D4]

Sign In for Pricing
View Details
OR5B12 (C-term) Rabbit Polyclonal Antibody
AP53086PU-N 400 µL

OR5B12 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF488A conjugate, 0.1mg/mL
BNC881989-100 1x 100 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details