Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1)
This Recombinant Human Putative Wilms tumor upstream neighbor 1 gene protein (WIT1) spans the amino acid sequence from region 1-92. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative Wilms tumor upstream neighbor 1 gene protein; WIT-1; Wilms tumor-associated antisense RNA; WT1-AS WIT1
UniProt
Q06250
Expression Region
1-92
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1410683 Inquire
Recombinant Lactobacillus delbrueckii subsp. bulgaricus DNA ligase (ligA), partial
Sign In for Pricing
View Details