Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 616 (ZN616)

This Recombinant Human Zinc finger protein 616 (ZN616) spans the amino acid sequence from region 1-781. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 616 ZNF616

UniProt

Q08AN1

Expression Region

1-781

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MATQGHLTFKDVAIEFSQEEWKCLEPVQKALYKDVMLENYRNLVFLGISPKCVIKELPPTENSNTGERFQTVALERHQSYDIENLYFREIQKHLHDLEFQWKDGETNDKEVPVPHENNLTGKRDQHSQGDVENNHIENQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVVHTRGKSYQCDVCGKIFRKNSYFVRHQRSHTGQKPYICNECGKSFSKSSHLAVHQRIHTGEKPYKCNLCGKSFSQRVHLRLHQTVHTGERPFKCNECGKTFKRSSNLTVHQVIHAGKKPYKCDVCGKAFRHRSNLVCHRRIHSGEKQYKCNECGKVFSKRSSLAVHRRIHTVEKPCKCNECGKVFSKRSSLAVHQRIHTGQKTYKCNKCGKVYSKHSHLAVHWRIHTGEKAYKCNECGKVFSIHSRLAAHQRIHTGEKPYKCNECGKVFSQHSRLAVHRRIHTGEKPYKCKECGKVFSDRSAFARHRRIHTGEKPYKCKECGKVFSQCSRLTVHRRIHSGEKPYKCNECGKVYSQYSHLVGHRRVHTGEKPYKCHECGKAFNQGSTLNRHQRIHTGEKPYKCNQCGNSFSQRVHLRLHQTVHTGDRPYKCNECGKTFKRSSNLTAHQIIHAGKKPYKCDECGKVFRHSSHLVSHQRIHTGEKRYKCIECGKAFGRLFSLSKHQRIHSGKKPYKCNECGKSFICRSGLTKHRIRHTGESLTTKLNVTRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Defb2 shRNA (UAS) - Lentiviral mouse Defb2 shRNA (UAS) (100)
GTR15134586 1 Vial

Lentiviral mouse Defb2 shRNA (UAS) - Lentiviral mouse Defb2 shRNA (UAS) (100)

Sign In for Pricing
View Details
CDHR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV674779 1.0 µg DNA

CDHR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SULT1B1 Antibody, Biotin conjugated
CSB-PA022937ED01HU-01 50 µg

SULT1B1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SULT1B1 Antibody, Biotin conjugated
CSB-PA022937ED01HU-02 100 µg

SULT1B1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SNX27 Antibody
orb681414 100 µL

SNX27 Antibody

Sign In for Pricing
View Details
Recombinant Mouse Cripto-1 Protein (Fc Tag)
PDMM100173-01 20 µg

Recombinant Mouse Cripto-1 Protein (Fc Tag)

Sign In for Pricing
View Details