Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RAD51-associated protein 2 (R51A2), partial

This Recombinant Human RAD51-associated protein 2 (R51A2), partial spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RAD51-associated protein 2 RAD51AP2

UniProt

Q09MP3

Expression Region

1-500

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSLPQPTPRMAELRKPTSSLTPPEDPDSQPPSSKRLCLEEPGGVFKAGWRLPLVPRLSEAEKVWELSPRPFKGLLVSTNAIFDNSTDSCVEKSVSGKQICNLKCSNLKFQMSSCLQSPPSQSPDSDLRASGRSEAGLHDREAFSVHRSNSSKAGVSQLLPSTSIHDIHGIRNENRKQQFVQGRDNVHKENPFLDVTFYKETKSPFHEIKNRCKANSVVPSNKRENNISSSVLKISKSQNQPSLEIAKPSYFRDSGTISVPQFPMDLNSKMSSVYLKEIAKKKNDKKEAYVRDFTNIYWSQNRPDVKKQKLQNDKKTVEAENIFSKCYENDYPSLSSQNTCKRKDLISSNYCNCSSIQCNVRDSRKNFAILENANWEEAECLDSYVLTRLEKSQNWDCNVRHILRRNRGNCWIINNCKTKCENMKKTEEKWNWLLLLEIDLLSKEDYHCAKVINAYEEQSKLLVREILGSQTALITTVWLNGKGENDNTLQLRYNTTQKVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat EGF Antibody Pair Set
E-KAB-0365 50 µL & 100 µg

Rat EGF Antibody Pair Set

Sign In for Pricing
View Details
PE Anti-Mouse CD28 Antibody[37.51]
E-AB-F1026D-01 50 Tests

PE Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details
PE Anti-Mouse CD28 Antibody[37.51]
E-AB-F1026D-02 100 Tests

PE Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details
PE Anti-Mouse CD28 Antibody[37.51]
E-AB-F1026D-03 2x 100 Tests

PE Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details
Histone H1 (1415-1), CF405S conjugate, 0.1mg/mL
BNC040580-500 1x 500 µL

Histone H1 (1415-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hydroxydiazinon
TRC-H215000-2.5MG 2.5 mg

Hydroxydiazinon

Sign In for Pricing
View Details