Recombinant Human XK-related protein 6 (XKR6), partial
This Recombinant Human XK-related protein 6 (XKR6), partial spans the amino acid sequence from region 494-641. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
XK-related protein 6 XKR6 C8orf21 C8orf5 C8orf7 XRG6
UniProt
Q5GH73
Expression Region
494-641
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
YYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
406689-01 50 µL
MAPK8IP2 (C-Jun-amino-terminal Kinase-interacting Protein 2, JIP-2, JNK-interacting Protein 2, Islet-brain-2, IB-2, JNK MAP Kinase Scaffold Protein 2, Mitogen-activated Protein Kinase 8-interacting Protein 2, MAPK8IP2, IB2, JIP2, PRKM8IPL)
Sign In for Pricing
View Details 406689-02 100 µL
MAPK8IP2 (C-Jun-amino-terminal Kinase-interacting Protein 2, JIP-2, JNK-interacting Protein 2, Islet-brain-2, IB-2, JNK MAP Kinase Scaffold Protein 2, Mitogen-activated Protein Kinase 8-interacting Protein 2, MAPK8IP2, IB2, JIP2, PRKM8IPL)
Sign In for Pricing
View Details 